PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 679aa    MW: 73850 Da    PI: 6.395
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-28959PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-29228281155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Lsa013079 228 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 281
                79*******************.********************************8 PP

2Response_reg80.46e-27531611109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l++ +y ev+ +  +e al  l+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a ++++ + + +  Ga 
     Lsa013079  53 VLVVDDDPTCLKILEKMLRNCNY-EVTKCNRAEVALSHLRENKngFDVVISDVHMPDMDGFKLLEHIGIEM-DLPVIMMSADDSKSVVMKGVTHGAC 147
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l++
     Lsa013079 148 DYLIKPVRIEALRN 161
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-17130674IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.4E-4350187No hitNo description
SuperFamilySSF521722.42E-3650174IPR011006CheY-like superfamily
SMARTSM004484.5E-3151163IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.84252167IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.9E-2453161IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.80E-2754166No hitNo description
PROSITE profilePS5129410.896225284IPR017930Myb domain
SuperFamilySSF466895.2E-20226285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-30227286IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-25228281IPR006447Myb domain, plants
PfamPF002499.8E-8230280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MNLGGGQVVN KQSMMPSSSG ASWKSTTGGG VSGGGGGGGD GGVPDQFPAG LRVLVVDDDP  60
TCLKILEKML RNCNYEVTKC NRAEVALSHL RENKNGFDVV ISDVHMPDMD GFKLLEHIGI  120
EMDLPVIMMS ADDSKSVVMK GVTHGACDYL IKPVRIEALR NIWQHVVRKR KHEWKEFEPS  180
ASADEQKPPE EPDYSSSANE GHNWKNTKRR KDEDDEADER DDSSSLKKPR VVWSVELHQQ  240
FVAAVNQLGI DKAVPKKILE LMNVPGLTRE NVASHLQKYR LYLRRLSGSQ HPGGLSTGFM  300
GSPEAGYGSI SSLNGLDLQA LAASGQLGQL PPQSLATLQA AALGRSNNSK SPISVPVIDQ  360
RNIFSFENPK RYTEVQSQHL TNNNNTNKQM NLLPGIPTNM EPKQFVSLHQ SGQHSFGSMN  420
NQVLIQMGGQ NQNQNQNQSQ SQGHGHGQSI PNAIPHHGMR QQPVLSSEML TRGGVVDLAT  480
TTVYNPVVSQ ASSLVDFSMN HKTDSSGNSY PIGGSLGISN ITSSSSTLQG DGSLDSKVSR  540
RGIVPSYDIF NDLNQNGYRD WGLQDVGLTF DQSPPVLLQH SRSSGQEMGG QNCNLTTTGT  600
HRNGSNIGQP RNAYVGENSL RVKAESFNDG SSHNNLYPEQ YGQDDLLAAI LKQQQQQESV  660
GQPENEFGFD GYALDNLPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-23224287164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519174.10.0PREDICTED: two-component response regulator ARR2 isoform X1
SwissprotQ9ZWJ91e-180ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A103XZK90.0A0A103XZK9_CYNCS; CheY-like superfamily (Fragment)
STRINGSolyc05g054390.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-162response regulator 2